PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04659.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 355aa    MW: 41328.4 Da    PI: 6.7443
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04659.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.41.2e-48691942128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              ppG+rF P+deel+v+yL+kkv ++ l+  + ikev++yk+ P++L  k    +ekewyfF++rd+ky++g+r+nra+ +gyWkat
  Sme2.5_04659.1_g00003.1  69 PPGYRFCPHDEELIVHYLRKKVMNEILPH-DRIKEVNLYKHSPQQLSeKYSMLGEKEWYFFTPRDRKYPNGDRPNRAAGTGYWKAT 153
                              9*************************999.88**************9444445899****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g d+++++ ++e+vg +k Lvfy+g+ pkg kt+W+mhe+r+
  Sme2.5_04659.1_g00003.1 154 GADRPIMH-NNEKVGFRKALVFYQGKPPKGDKTNWIMHEFRV 194
                              ********.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-5765220IPR003441NAC domain
PROSITE profilePS5100555.22868220IPR003441NAC domain
PfamPF023652.8E-2569194IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MESDEQSKAL TSQSSKMQKI VKQKHSGDET AMVLKPNYNI NTYGKRVYVD DNINTNGKRV  60
YVDDNFVYPP GYRFCPHDEE LIVHYLRKKV MNEILPHDRI KEVNLYKHSP QQLSEKYSML  120
GEKEWYFFTP RDRKYPNGDR PNRAAGTGYW KATGADRPIM HNNEKVGFRK ALVFYQGKPP  180
KGDKTNWIMH EFRVDESRRL KAHASDMRLD DWVLCRIYKK INKLSPKGPQ KEEQERERKQ  240
EDASKSTSPV GKVEVVNCDY EGNMYSCVRQ PFELSLPQHM TDPNLYSLDN LSFYGSRLSD  300
YEMNLQSSLL SDHNIVPMSF DFNLLDPHEI MGAIESKNVL NIGDLDENSS SDEED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D8e-596922021168NAC domain-containing protein 19
3swp_C8e-596922021168NAC domain-containing protein 19
3swp_B8e-596922021168NAC domain-containing protein 19
3swp_A8e-596922021168NAC domain-containing protein 19
3swm_D8e-596922021168NAC domain-containing protein 19
3swm_C8e-596922021168NAC domain-containing protein 19
3swm_B8e-596922021168NAC domain-containing protein 19
3swm_A8e-596922021168NAC domain-containing protein 19
4dul_B9e-596922018165NAC domain-containing protein 19
4dul_A9e-596922018165NAC domain-containing protein 19
1ut7_B9e-596922018165NO APICAL MERISTEM PROTEIN
1ut7_A9e-596922018165NO APICAL MERISTEM PROTEIN
1ut4_B9e-596922018165NO APICAL MERISTEM PROTEIN
1ut4_A9e-596922018165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755232e-75HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546854.11e-149PREDICTED: NAC domain-containing protein 72-like
SwissprotA0SPJ92e-68NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLM1DSS71e-102M1DSS7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000938221e-101(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.18e-63NAC domain containing protein 32